web.ntfb.orgNorth Texas Food Bank | NTFB.org - North Texas Food Bank - Feeding America - North Texas Food Bank

web.ntfb.org Profile

Web.ntfb.org is a subdomain of ntfb.org, which was created on 1999-09-02,making it 26 years ago. It has several subdomains, such as volunteer.ntfb.org staging.ntfb.org , among others.

Description:North Texas Food Bank (NTFB) is a hunger relief organization and one of the largest North Texas charity. NTFB serves Dallas and 12 surrounding...

Discover web.ntfb.org website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

web.ntfb.org Information

HomePage size: 63.428 KB
Page Load Time: 0.466992 Seconds
Website IP Address: 161.47.92.246

web.ntfb.org Similar Website

Bank of America Merrill Lynch is Now Bank of America & BofA Securities
business.bofa.com
Bank of America Careers Site - Apply at Bank of America
careers.bankofamerica.com
IDEMIA North America - IDEMIA North America
na.idemia.com
WEISS North America - WEISS North America, Inc.
info.weissna.com
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
Feeding Matters – Infant and Child Feeding Questionnaire©
questionnaire.feedingmatters.org
Kyowa Kirin North America Homepage, a Specialty Pharmaceutical Company | Kyowa Kirin North America
kkna.kyowakirin.com
North America Interest Rates - Compare North American Bank Rates
north-america.deposits.org
St. Louis Area Foodbank | Member of Feeding America
slafb.convio.net
U.S. Hunger Relief Organization | Feeding America
help.feedingamerica.org
OneCPM - Feeding, Fueling & Building
corporate.cpm.net
Bank of America Performing Arts Center Thousand Oaks | Bank of America Performing Arts Center Thousa
m.civicartsplaza.com
Intellectual Takeout Feeding Minds Pursuing Truth
library.intellectualtakeout.org
Episcopal Diocese of Los Angeles Feeding Hungry Hearts
stjames.ladiocese.org
Feeding America West Michigan – Solving hunger in West
orders.feedwm.org

web.ntfb.org PopUrls

Blackbaud - North Texas Food Bank
https://web.ntfb.org/

web.ntfb.org Httpheader

Cache-Control: private
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Vary: Accept-Encoding
x-frame-options: SAMEORIGIN
X-UA-Compatible: IE=edge
Set-Cookie: ASP.NET_SessionId=z2mjh6CBoNb0uzipEjrdBpQNf3U_|_vokw0vbexk4fbp3jicqbr0hj; path=/; secure; HttpOnly; SameSite=Lax, CSRF_TOKEN=b7a940bdb0224cf69b5339c3bc4aaeb9; path=/; HttpOnly, BIGipServerPOOL-161.47.92.246-443=1008210092.20480.0000; path=/; Httponly; Secure
Date: Wed, 29 Jan 2020 21:08:43 GMT
Content-Length: 19709

web.ntfb.org Ip Information

Ip Country: United States
Latitude: 37.751
Longitude: -97.822

web.ntfb.org Html To Plain Text

File not found and throwing 404Agency Zone Newsroom Careers Contact Us Blog facebook twitter instagram linkedin Search: Search I Want to Learn More I Want to Get Involved I Need Food Assistance I Want to Donate Help us tackle hunger leading up to the Big Game through Souper Bowl of Caring! Join us for the 21st annual Empty Bowls on February 27, 2020! Purchase your tickets today! Check out our canned food drive handbook for tips on hosting a canned food drive! Celebrate your special day with a pack and party at NTFB! Click here to reserve your spot. Welcome to Our Food Bank The North Texas Food Bank (NTFB) is a top-ranked nonprofit relief organization, providing access to more than 200,000 meals each day for hungry children, seniors and families across a 13-county service area. In our last fiscal year, NTFB and our feeding network provided access to nearly 77 million meals. The need for hunger relief in North Texas is much larger; to combat increasing food insecurity in North Texas, the Food Bank recently launched a 10-year plan to provide access to 92 million nutritious meals annually by 2025 . NTFB is a member of Feeding America, a national hunger relief organization. Learn more about NTFB. Twitter Facebook BlogYouTube Tweets by @ntfb77 million meals Nearly 77 million meals provided to hungry North Texans last year because of your help. Events & Campaigns Take a look at the current and upcoming events and campaigns that are helping to fight hunger in our community! Learn More Community Partnerships Support for NTFB includes financial gifts, nutritious product, volunteerism and a commitment to the community. Support from Target includes financial gifts to benefit NTFB’s School Pantry program for the 2016-2017 school year. Support from Walmart and the Walmart Foundation includes financial gifts, nutritious food donations, volunteerism and on-going support in our community’s fight against hunger. Agency Zone Board Member Login I Want to Learn More About NTFB Our History Our Promise Awards Financials 92 Million Meals About 92 Million Meals Boilerplate Programs Child Programs Plano Peanut Butter Drive Disaster Relief Nutrition Services Partner Agencies Senior Programs SNAP Outreach Hunger Facts Leadership NTFB Board LIFE Council Celebrity Council Jan Pruitt CEO Announcement Indian American Council Young Advocates Council Newsroom In the News 2019 2018 Crossroads HUB Annoucement 2017 2016 2015 2014 2013 Media Releases 2019 2018 2017 2016 2015 2014 2013 2012 2011 2010 Videos Blog Request a Speaker Thank You Careers Benefits Apply Newsletters Ethics Reporting Non-Discrimination Statement I Want to Get Involved Donate Money Donate Now In Honor/In Memory Tribute Gifts of Stock Estate Planning Volunteer and Donate Letter Writing Campaign Donate Plano Food 4 Kids Back 2 School Set Up Monthly Donations FY17 Donate Direct Mail Landing Pages Fall News 2017 Disaster Relief & Hunger Start a Fundraiser title Volunteer Volunteer Request Form Thank You Be a Kernel Volunteer FAQs Donate Food Canned Food Drive Start My Canned Food Drive Thank You Pick Up Request Pick-Up Request Thank You Food Industry Donations Food Industry Donation Form Thank You Advocate Estate Planning Planned Giving Survey Become a Partner Agency Events and Campaigns Community Partnerships title Register Hunger Action Month State Fair of Texas Canstruction Scots 4 Turkeys Coppell Family Feast Drive Souper Bowl of Caring Empty Bowls presented by Kroger Dash Down Greenville Brewfest KRLD Restaurant Week Full on Faith Dallas Mayor’s Back to School Fair Kroger Ultimate Mavs Fan Package HeatherBelle’s Heavenly Bites North Texas Giving Day Giving Tuesday Tacolandia Holiday Partner Thank You Mercantile Trunk Show Treats of Christmas Friendsgiving Christmas Carol Whole Foods Market Giving Campaign Nurture Burger Santa Days 2017 Foodies For Philanthropy Lync Cycling Food Drive Photos with Santa 33 Restaurant Group Holiday Campaign Dallas Opera Family Season 2018 Krewe De Roux Boudin Ball LUCK Chili Challenge Trinity Falls Crawfish Boil Test Event Name | Events Walmart Dallas Holocaust Museum Center Series: Paths Out of Poverty Anna Sova Corporate Involvement Event Sponsorships Employee Giving Partners 4 Hope Volunteering Frequently Asked Questions eStore I Need Food Assistance Locate a Partner Agency SNAP Information Get Assistance 10 Myths About SNAP Senior Food Assistance Donate Newsroom Blog Privacy Policy Contact Us Careers Style Guide North Texas Food Bank | 3677 Mapleshade Lane, Plano Texas, 75075 | 214.330.1396 | North Texas Food Bank is a 501(c)(3) non-profit organization. | EIN: 75-1785357 |...

web.ntfb.org Whois

Domain Name: ntfb.org Registry Domain ID: b3305d621fed4a4f94bb05317b66e85b-LROR Registrar WHOIS Server: whois.networksolutions.com Registrar URL: http://www.networksolutions.com Updated Date: 2022-10-17T13:57:52Z Creation Date: 1999-09-02T13:57:02Z Registry Expiry Date: 2027-09-02T13:57:02Z Registrar: Network Solutions, LLC Registrar IANA ID: 2 Registrar Abuse Contact Email: domain.operations@web.com Registrar Abuse Contact Phone: +1.8777228662 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registrant Organization: North Texas Food Bank Registrant State/Province: TX Registrant Country: US Name Server: ns3.worldnic.com Name Server: ns4.worldnic.com DNSSEC: unsigned >>> Last update of WHOIS database: 2024-05-17T14:22:48Z <<<